PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_005786-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 254aa    MW: 28653 Da    PI: 7.0238
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_005786-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-171257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+++Ed +l ++v+q G+++W++I++ ++ gR++k+c++rw + 
    NNU_005786-RA 12 KGSWSPDEDAKLTRLVEQNGPRNWSLISSGIP-GRSGKSCRLRWCNQ 57
                     799*****************************.***********985 PP

2Myb_DNA-binding55.71.1e-1766108347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+ Ed ++++a++ +G++ W+tIar ++ gRt++ +k++w++ 
    NNU_005786-RA  66 PFTPAEDAIIIKAHATHGNK-WATIARLLP-GRTDNAIKNHWNST 108
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.897758IPR017930Myb domain
SuperFamilySSF466896.74E-3010105IPR009057Homeodomain-like
SMARTSM007172.4E-151160IPR001005SANT/Myb domain
PfamPF002494.0E-171257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-231365IPR009057Homeodomain-like
CDDcd001672.39E-131456No hitNo description
PROSITE profilePS5129424.74659113IPR017930Myb domain
SMARTSM007172.7E-1563111IPR001005SANT/Myb domain
CDDcd001671.27E-1166109No hitNo description
Gene3DG3DSA:1.10.10.608.6E-2466113IPR009057Homeodomain-like
PfamPF002494.7E-1566108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MVVGLNAGDR IKGSWSPDED AKLTRLVEQN GPRNWSLISS GIPGRSGKSC RLRWCNQLSP  60
LVQHRPFTPA EDAIIIKAHA THGNKWATIA RLLPGRTDNA IKNHWNSTLR RRLASESFSA  120
TSDPESESDS VRKRRCLRVS PENNSCNDDD DADEQRKAEP ATLLTLSPPG ESLGTAYGKV  180
EEEVVVKRDS EEREKERCTV EIKDMYLMNI VQRMIAEEVR NYIDKVRAKG ELALGFESGT  240
DQNTHNTWEL RNRD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-37111133105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010253806.10.0PREDICTED: transcription factor MYB44-like
TrEMBLF6HCB32e-92F6HCB3_VITVI; Putative uncharacterized protein
STRINGVIT_13s0067g01360.t015e-92(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.12e-55myb domain protein 77